PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.E01581.1.p
Common NameEUGRSUZ_E01581
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family MYB
Protein Properties Length: 299aa    MW: 33264.5 Da    PI: 6.4357
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.E01581.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding39.81e-12751246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
   Myb_DNA-binding  2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                      g+W +eEd+ l+  vk++G+++W++I ++  + Rt+k+c++rw +
  Eucgr.E01581.1.p  7 GPWKAEEDDVLISHVKKYGPRDWSSIRSKGLLQRTGKSCRLRWVN 51
                      89************************8887799**********87 PP

2Myb_DNA-binding44.34.1e-1462101344
                       SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHH CS
   Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrw 44 
                       ++++eE+   +++ +q+G++ W++Ia +++ gRt++++k++w
  Eucgr.E01581.1.p  62 KFSAEEERVVIELQAQFGNK-WARIATHLP-GRTDNDVKNFW 101
                       79******************.*********.*********** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.229153IPR017930Myb domain
SMARTSM007175.5E-8555IPR001005SANT/Myb domain
SuperFamilySSF466891.8E-266101IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.609.7E-20760IPR009057Homeodomain-like
CDDcd001673.59E-11853No hitNo description
PfamPF139214.3E-12959No hitNo description
PROSITE profilePS5129420.25254109IPR017930Myb domain
SMARTSM007171.1E-1259107IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.6E-1961107IPR009057Homeodomain-like
CDDcd001675.02E-1162101No hitNo description
PfamPF002493.0E-1262101IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048235Biological Processpollen sperm cell differentiation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 299 aa     Download sequence    Send to blast
MWGEWGGPWK AEEDDVLISH VKKYGPRDWS SIRSKGLLQR TGKSCRLRWV NKLRPNLKNG  60
CKFSAEEERV VIELQAQFGN KWARIATHLP GRTDNDVKNF WSSRQKRLAR ILQASSSKQH  120
KHKRDVPKLS SSAEEESTSR AHLCTMPHIA DPPPPLRLLP PPPDLPNPGT PSASSHLAPH  180
EFNSSEGLYS DPHMQIPFPH IPLAQFGISF SPESQDPMST LDDPDYFSLL GPGDDASELV  240
DGEGFPPDMP LLDPSLCCKG GDSMMRGNVN VGKPDIFFDD LPLDVPDHFE PLPSPSKW*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-26710728126MYB TRANSFORMING PROTEIN
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.E01581.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010058514.10.0PREDICTED: transcription factor MYB82
TrEMBLA0A059C4G10.0A0A059C4G1_EUCGR; Uncharacterized protein
STRINGVIT_15s0021g02040.t011e-98(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM65512842
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G60460.11e-68MYB family protein